Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PPP1R3B Antibody, Novus Biologicals™

PPP1R3B Antibody, Novus Biologicals™
SDP

Catalog No. NB407199 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB407199 25 μL
NBP182243 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB407199 Supplier Novus Biologicals Supplier No. NBP18224325UL
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

PPP1R3B Polyclonal specifically detects PPP1R3B in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen PPP1R3B
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias FLJ14005, FLJ34675, GL, Hepatic glycogen-targeting protein phosphatase 1 regulatory subunit GL, PPP1R4PP1 subunit R4, protein phosphatase 1 regulatory subunit 3B, Protein phosphatase 1 regulatory subunit 4, Protein phosphatase 1 subunit GL, protein phosphatase 1, regulatory (inhibitor) subunit 3B
Gene Symbols PPP1R3B
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:DRDTFSFDISLPEKIQSYERMEFAVYYECNGQTYWDSNRGKNYRIIRAELKSTQGMTKPHSGPDLGISFDQFGSPRCSYGLF
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline metabolism
Primary or Secondary Primary
Gene ID (Entrez) 79660
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.