Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PRKRIP1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | PRKRIP1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
PRKRIP1 Polyclonal specifically detects PRKRIP1 in Human samples. It is validated for Western Blot.Specifications
| PRKRIP1 | |
| Polyclonal | |
| Rabbit | |
| Q9H875 | |
| 79706 | |
| Synthetic peptides corresponding to PRKRIP1(PRKR interacting protein 1 (IL11 inducible)) The peptide sequence was selected from the N terminal of PRKRIP1. Peptide sequence MASPAASSVRPPRPKKEPQTLVIPKNAAEEQKLKLERLMKNPDKAVPIPE. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| C114, FLJ13902, FLJ40957, KRAB box domain containing 3, KRBOX3, likely ortholog of mouse C114 dsRNA-binding protein, PRKR interacting protein 1 (IL11 inducible), PRKR-interacting protein 1 | |
| PRKRIP1 | |
| IgG | |
| 21 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title