Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Proteasome 20S beta 6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$158.00 - $487.50
Specifications
Antigen | Proteasome 20S beta 6 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP15657520
![]() |
Novus Biologicals
NBP15657520UL |
20 μL |
Each for $158.00
|
|
|||||
NBP156575
![]() |
Novus Biologicals
NBP156575 |
100 μL |
Each for $487.50
|
|
|||||
Description
Proteasome 20S beta 6 Polyclonal specifically detects Proteasome 20S beta 6 in Human samples. It is validated for Western Blot.Specifications
Proteasome 20S beta 6 | |
Polyclonal | |
Rabbit | |
Core ESC Like Genes, Stem Cell Markers | |
DELTA, EC 3.4.25.1, LMPY, Macropain delta chain, Multicatalytic endopeptidase complex delta chain, proteasome (prosome, macropain) subunit, beta type, 6, proteasome catalytic subunit 1, Proteasome delta chain, proteasome subunit beta 6, proteasome subunit beta type-6, proteasome subunit delta, Proteasome subunit Y, PSY large multifunctional protease Y, YMGC5169 | |
PSMB6 | |
IgG | |
This product is specific to Subunit or Isoform: beta type-6. |
Western Blot | |
Unconjugated | |
RUO | |
P28072 | |
5694 | |
Synthetic peptides corresponding to PSMB6(proteasome (prosome, macropain) subunit, beta type, 6) The peptide sequence was selected from the N terminal of PSMB6. Peptide sequence TTIMAVQFDGGVVLGADSRTTTGSYIANRVTDKLTPIHDRIFCCRSGSAA. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title