PTHLH/PTHrP Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP303168

Catalog No. NB093572

Description

PTHLH/PTHrP Polyclonal specifically detects PTHLH/PTHrP in Human, Mouse samples. It is validated for Western Blot, Flow Cytometry, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: PTHLH/PTHrP
• Classification: Polyclonal
• Dilution: Western Blot 1:500-1:1000, Flow Cytometry 1:20-1:50, Immunohistochemistry 1:50-1:100, Immunohistochemistry-Paraffin
• Gene Alias: BDE2, HHM, MGC14611, parathyroid hormone-like hormone, Parathyroid hormone-like protein, parathyroid hormone-related protein, PLPosteostatin, PTHR, PTH-related protein, PTHrP, PTH-rP, PTHRPparathyroid hormone-like related protein
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 74-130 of human PTHLH/PTHrP (NP_945316.1). ATSEVSPNSKPSPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTPGKKKKGKP
• Quantity: 100 μL
• Research Discipline: Biologically Active Proteins, Cell Cycle and Replication
• Gene ID (Entrez): 5744
• Content And Storage: Store at 4°C. Do not freeze.
• Isotype: IgG

• Applications: Western Blot, Flow Cytometry, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS with 50% glycerol, pH7.3.
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse
• Form: Purified