Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. RAD9B Antibody, Novus Biologicals™

RAD9B Antibody, Novus Biologicals™
SDP

Catalog No. p-200040303 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB418950 25 μL
NBP183452 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB418950 Supplier Novus Biologicals Supplier No. NBP18345225UL
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

RAD9B Polyclonal specifically detects RAD9B in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen RAD9B
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias cell cycle checkpoint control protein RAD9B, cell cycle checkpoint control protein RAD9B homolog, DNA repair exonuclease rad9 homolog B, FLJ40346, hRAD9B, MGC75426, RAD9 homolog B (S. pombe)
Gene Symbols RAD9B
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:RHGIKRTHNICFQESQPLQVIFDKNVCTNTLMIQPRLLADAIVLFTSSQEEVTLAVTPLNFCLKSSNEESMDLSNAVHSEMFVGSDEFDFFQIGMD
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Cell Cycle and Replication
Primary or Secondary Primary
Gene ID (Entrez) 144715
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.