Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RBP7 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $646.00
Specifications
Antigen | RBP7 |
---|---|
Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
RBP7 Polyclonal specifically detects RBP7 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
RBP7 | |
Polyclonal | |
Rabbit | |
Human, Mouse, Rat | |
Cellular retinoic acid-binding protein 4, Cellular retinoic acid-binding protein IV, CRABP4, CRABP-IV, CRBP4, CRBPIV, MGC70641, putative cellular retinol-binding protein CRBP IV, retinoid binding protein 7, retinoid-binding protein 7, retinol binding protein 7, cellular | |
RBP7 | |
IgG | |
Affinity Purified | |
Specificity of human RBP7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
116362 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:RKIAKLLKPQKVIEQNGDSFTIHTNSSLRNYFVKFKVGEEFDEDNRGLDNRKCKSLVIWDNDRLTCIQKGEK | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title