Retinol Binding Protein RBP Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP157677

Catalog No. NBP157677

Description

Retinol Binding Protein RBP Polyclonal specifically detects Retinol Binding Protein RBP in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Retinol Binding Protein RBP
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: C, Cellular retinol-binding protein, CRABP-I, CRBP1CRBP-I, CRBPCellular retinol-binding protein I, CRBPI, RBPC, retinol binding protein 1, cellular, retinol-binding protein 1, retinol-binding protein 1, cellular
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 5947
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P09455
• Gene Symbols: RBP1
• Immunogen: Synthetic peptides corresponding to RBP1(retinol binding protein 1, cellular) The peptide sequence was selected from the middle region of RBP1. Peptide sequence IIRTLSTFRNYIMDFQVGKEFEEDLTGIDDRKCMTTVSWDGDKLQCVQKG.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Guinea pig: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Chicken: 85%; Xenopus: 84%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Form: Purified