Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Retinol Binding Protein RBP Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$480.74
Specifications
| Antigen | Retinol Binding Protein RBP |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
Description
Retinol Binding Protein RBP Polyclonal specifically detects Retinol Binding Protein RBP in Human samples. It is validated for Western Blot.Specifications
| Retinol Binding Protein RBP | |
| Polyclonal | |
| Purified | |
| RUO | |
| C, Cellular retinol-binding protein, CRABP-I, CRBP1CRBP-I, CRBPCellular retinol-binding protein I, CRBPI, RBPC, retinol binding protein 1, cellular, retinol-binding protein 1, retinol-binding protein 1, cellular | |
| RBP1 | |
| IgG | |
| Protein A purified |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| P09455 | |
| 5947 | |
| Synthetic peptides corresponding to RBP1(retinol binding protein 1, cellular) The peptide sequence was selected from the middle region of RBP1. Peptide sequence IIRTLSTFRNYIMDFQVGKEFEEDLTGIDDRKCMTTVSWDGDKLQCVQKG. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title