Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Retinol Binding Protein RBP Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | Retinol Binding Protein RBP |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Form | Purified |
Description
Retinol Binding Protein RBP Polyclonal specifically detects Retinol Binding Protein RBP in Human samples. It is validated for Western Blot.Specifications
Retinol Binding Protein RBP | |
Polyclonal | |
Purified | |
RUO | |
C, Cellular retinol-binding protein, CRABP-I, CRBP1CRBP-I, CRBPCellular retinol-binding protein I, CRBPI, RBPC, retinol binding protein 1, cellular, retinol-binding protein 1, retinol-binding protein 1, cellular | |
RBP1 | |
IgG | |
Protein A purified |
Western Blot | |
Unconjugated | |
Rabbit | |
P09455 | |
5947 | |
Synthetic peptides corresponding to RBP1(retinol binding protein 1, cellular) The peptide sequence was selected from the middle region of RBP1. Peptide sequence IIRTLSTFRNYIMDFQVGKEFEEDLTGIDDRKCMTTVSWDGDKLQCVQKG. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title