Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RGS13 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP31711225UL
This item is not returnable.
View return policy
Description
RGS13 Polyclonal antibody specifically detects RGS13 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| RGS13 | |
| Polyclonal | |
| Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| MGC17173, regulator of G-protein signaling 13, regulator of G-protein signalling 13 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: TYKKIASRWSRISRAKKLYKIYIQPQSPREINIDSSTRETIIRNIQEPTETCFEEAQK | |
| 25 μg | |
| Signal Transduction | |
| 6003 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS, pH 7.2, 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction