Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. RIZ1 Antibody, Novus Biologicals™

RIZ1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP189644 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP189644 0.1 mL
NB405875 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP189644 Supplier Novus Biologicals Supplier No. NBP189644
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

RIZ1 Polyclonal specifically detects RIZ1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen RIZ1
Applications Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:20-1:50
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias EC 2.1.1.43, GATA-3 binding protein G3B, GATA-3-binding protein G3B, KMT8PR domain-containing protein 2, Lysine N-methyltransferase 8, MTB-ZFHUMHOXY1, PR domain containing 2, with ZNF domain, PR domain zinc finger protein 2, retinoblastoma protein-binding zinc finger protein, Retinoblastoma protein-interacting zinc finger protein, RIZ1, RIZ2, RIZMTE-binding protein, Zinc finger protein RIZ, zinc-finger DNA-binding protein
Gene Symbols PRDM2
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:PPPFQYHHRNPMGIGVTATNFTTHNIPQTFTTAIRCTKCGKGVDNMPELHKHILACASASDKKRYTPKKNPVPLKQTVQPKNGVVVLDNSGKNAFRRMGQPKRLNFSVELSKMSSNKLKLNALKKKNQLVQKAI
Purification Method Affinity Purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Breast Cancer, Chromatin Research
Primary or Secondary Primary
Gene ID (Entrez) 7799
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.