RNF125 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP155373

Catalog No. NBP155373

Description

RNF125 Polyclonal specifically detects RNF125 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: RNF125
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: E3 ubiquitin-protein ligase RNF125, EC 6.3.2.-, FLJ20456, MGC21737, ring finger protein 125TRAC1, T-cell RING activation protein 1, T-cell ring protein identified in activation screen, TRAC-1
• Host Species: Rabbit
• Molecular Weight of Antigen: 26 kDa
• Quantity: 100 μL
• Research Discipline: Zinc Finger
• Gene ID (Entrez): 54941
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q96EQ8
• Gene Symbols: RNF125
• Immunogen: Synthetic peptides corresponding to RNF125 (ring finger protein 125) The peptide sequence was selected from the middle region of RNF125)(50ug). Peptide sequence ENPSSFSGSLIRHLQVSHTLFYDDFIDFNIIEEALIRRVLDRSLLEYVNH.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.