Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RPS15A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | RPS15A |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
RPS15A Polyclonal specifically detects RPS15A in Human samples. It is validated for Western Blot.Specifications
RPS15A | |
Polyclonal | |
Rabbit | |
P62244 | |
6210 | |
Synthetic peptides corresponding to RPS15A(ribosomal protein S15a) The peptide sequence was selected from the middle region of RPS15A. Peptide sequence KCGVISPRFDVQLKDLEKWQNNLLPSRQFGFIVLTTSAGIMDHEEARRKH. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
40S ribosomal protein S15a, FLJ27457, MGC111208, ribosomal protein S15a, S15a, up-regulated by HBV X protein | |
RPS15A | |
IgG | |
15 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title