Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RTP4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
Antigen | RTP4 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP15644820
![]() |
Novus Biologicals
NBP15644820UL |
20 μL |
Each for $206.00
|
|
|||||
NBP156448
![]() |
Novus Biologicals
NBP156448 |
100 μL |
Each for $487.50
|
|
|||||
Description
RTP4 Polyclonal specifically detects RTP4 in Human samples. It is validated for Western Blot.Specifications
RTP4 | |
Polyclonal | |
Rabbit | |
Human | |
IFRG28receptor transporting protein 4, receptor (chemosensory) transporter protein 4,28kD interferon responsive protein, receptor transporter protein 4, receptor-transporting protein 4,28 kDa interferon-responsive protein | |
RTP4 | |
IgG |
Western Blot | |
Unconjugated | |
RUO | |
Q96DX8 | |
64108 | |
Synthetic peptides corresponding to RTP4 (receptor (chemosensory) transporter protein 4) The peptide sequence was selected from the middle region of RTP4)(50ug). Peptide sequence SSDSTMRILSNLVQHILKKYYGNGTRKSPEMPVILEVSLEGSHDTANCEA. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title