RXFP3/RLN3R1/SALPR Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP191963

Catalog No. NBP191963

Description

RXFP3/RLN3R1/SALPR Polyclonal specifically detects RXFP3/RLN3R1/SALPR in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: RXFP3/RLN3R1/SALPR
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: G protein-coupled receptor SALPR, GPCR135MGC141998, G-protein coupled receptor SALPR, relaxin 3 receptor 1, Relaxin family peptide receptor 3RLN3 receptor 1, relaxin/insulin-like family peptide receptor 3, relaxin-3 receptor 1, RLN3R1MGC142000, RXFPR3, SALPRG-protein coupled receptor GPCR135, somatostatin and angiotensin-like peptide receptor, Somatostatin- and angiotensin-like peptide receptor
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: RXFP3
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:MQMADAATIATMNKAAGGDKLAELFSLVPDLLEAANTSGNASLQLPDLWWELGLELPDG
• Quantity: 0.1 mL
• Research Discipline: GPCR
• Gene ID (Entrez): 51289
• Target Species: Human
• Isotype: IgG

For Research Use Only