Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SEPN1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$206.00 - $487.50

Specifications

Antigen	SEPN1
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit
Regulatory Status	RUO

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP16905820 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP16905820UL	20 μL	Each for $206.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP169058 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP169058	100 μL	Each for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

SEPN1 Polyclonal specifically detects SEPN1 in Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen	SEPN1
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Alias	FLJ24021, rigid spine muscular dystrophy 1, RSMD1, RSS, selenoprotein N, selenoprotein N, 1, SelN, SELNMDRS1
Gene Symbols	SEPN1
Isotype	IgG
Molecular Weight of Antigen	62 kDa

Classification	Polyclonal
Host Species	Rabbit
Gene Accession No.	D3Z5N3
Gene ID (Entrez)	57190
Immunogen	Synthetic peptides corresponding to Sepn1 (selenoprotein N, 1) The peptide sequence was selected from the C terminal of Sepn1. Peptide sequence VHHINANYFLDITSMKPEDMENNNVFSFSSSFEDPSTATYMQFLREGLRR.
Primary or Secondary	Primary

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

SEPN1 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents