Serpin C1/Antithrombin-III Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP15791820UL

Catalog No. NBP15791820

Description

Serpin C1/Antithrombin-III Polyclonal specifically detects Serpin C1/Antithrombin-III in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Serpin C1/Antithrombin-III
• Classification: Polyclonal
• Dilution: Western Blot 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
• Gene Accession No.: P01008
• Gene Symbols: SERPINC1
• Immunogen: Synthetic peptides corresponding to SERPINC1(serpin peptidase inhibitor, clade C (antithrombin), member 1) The peptide sequence was selected from the middle region of SERPINC1. Peptide sequence ISEKTSDQIHFFFAKLNCRLYRKANKSSKLVSANRLFGDKSLTFN
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 462
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS & 2% Sucrose. with No Preservative
• Gene Alias: AT3antithrombin-III, ATIIIantithrombin III, MGC22579, serine (or cysteine) proteinase inhibitor, clade C (antithrombin), member 1, serine-cysteine proteinase inhibitor clade C member 1, Serpin C1, serpin peptidase inhibitor, clade C (antithrombin), member 1
• Host Species: Rabbit
• Molecular Weight of Antigen: 52 kDa
• Quantity: 20 μL
• Primary or Secondary: Primary
• Target Species: Human
• Isotype: IgG