Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Serpin C1/Antithrombin-III Antibody, Novus Biologicals™

Serpin C1/Antithrombin-III Antibody, Novus Biologicals™
SDP

Catalog No. NBP15791820 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15791820 20 μL
NBP157918 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15791820 Supplier Novus Biologicals Supplier No. NBP15791820UL

Description

Rabbit Polyclonal Antibody

Serpin C1/Antithrombin-III Polyclonal specifically detects Serpin C1/Antithrombin-III in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen Serpin C1/Antithrombin-III
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
Formulation PBS & 2% Sucrose. with No Preservative
Gene Accession No. P01008
Gene Alias AT3antithrombin-III, ATIIIantithrombin III, MGC22579, serine (or cysteine) proteinase inhibitor, clade C (antithrombin), member 1, serine-cysteine proteinase inhibitor clade C member 1, Serpin C1, serpin peptidase inhibitor, clade C (antithrombin), member 1
Gene Symbols SERPINC1
Host Species Rabbit
Immunogen Synthetic peptides corresponding to SERPINC1(serpin peptidase inhibitor, clade C (antithrombin), member 1) The peptide sequence was selected from the middle region of SERPINC1. Peptide sequence ISEKTSDQIHFFFAKLNCRLYRKANKSSKLVSANRLFGDKSLTFN
Molecular Weight of Antigen 52 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 462
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.