Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SETDB1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
| Antigen | SETDB1 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
SETDB1 Polyclonal specifically detects SETDB1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| SETDB1 | |
| Polyclonal | |
| Rabbit | |
| Epigenetics, Transcription Factors and Regulators | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 9869 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SGTSRKPTAGQTSATAVDSDDIQTISSGSEGDDFEDKKNMTGPMKRQVAVKSTRGFALKSTHGIAIKSTNMASVDKGESAPVRKNTRQFYDGEESCY | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| ERG-associated protein with SET domain, ESETEC 2.1.1.43, H3-K9-HMTase 4, Histone H3-K9 methyltransferase 4, histone-lysine N-methyltransferase SETDB1, histone-lysine N-methyltransferase, H3lysine-9 specific 4, KG1T, KIAA0067H3-K9-HMTase4, KMT1EERG-associated protein with a SET domain, ESET, Lysine N-methyltransferase 1E, SET domain bifurcated 1, SET domain, bifurcated 1 | |
| SETDB1 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title