Learn More
Description
Specifications
Specifications
| Antigen | SGLT2/SLC5A2 |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot reactivity reported in scientific literature (PMID: 25894829)., Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence reactivity reported in scientific literature (PMID: 25894829)., Immunohistochemistry-Paraffin 1:1000 - 1:2500 |
| Formulation | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Gene Alias | Low affinity sodium-glucose cotransporter, Na(+)/glucose cotransporter 2, SGLT2sodium/glucose cotransporter 2, solute carrier family 5 (sodium/glucose cotransporter), member 2, solute carrier family 5 (sodium/glucose transporter), member 2, Solute carrier family 5 member 2 |
| Gene Symbols | SLC5A2 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:FHEVGGYSGLFDKYLGAATSLTVSEDPAVGNISSFCYRPRPDSYHLL |
| Show More |
For Research Use Only
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
