SIT1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB438594	Novus Biologicals NBP21331125UL	25ul
NBP213311	Novus Biologicals NBP213311	0.1 mL

Description

SIT1 Polyclonal specifically detects SIT1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: SIT1
• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Alias: gp30/40, MGC125908, MGC125909, RP11-331F9.5, SHP2 interacting transmembrane adaptor, SHP2-interacting transmembrane adapter protein, SHP2-interacting transmembrane adaptor protein, signaling threshold regulating transmembrane adaptor 1, signaling threshold-regulating transmembrane adapter 1, SITMGC125910, suppression inducing transmembrane adaptor 1, Suppression-inducing transmembrane adapter 1
• Gene Symbols: SIT1
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Signal Transduction
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 27240
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: GRSGESVEEVPLYGNLHYLQTGRLSQDPEPDQQDPTLGGPARAAEEVMCYTSLQLRPPQGRIPGPGTPVKYSEVVLDSEPKSQASGPEPELYASVCAQTR
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only