SLC25A24 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP160063

Catalog No. NBP160063

Description

SLC25A24 Polyclonal specifically detects SLC25A24 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: SLC25A24
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Symbols: SLC25A24
• Immunogen: Synthetic peptides corresponding to SLC25A24(solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 24) The peptide sequence was selected from the middle region of SLC25A24. Peptide sequence FLFNPVTDIEEIIRFWKHSTGIDIGDSLTIPDEFTEDEKKSGQWWRQLLA The peptide sequence for this immunogen was taken from within the described region.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Canine: 100%; Guinea pig: 100%; Equine: 100%; Rat: 100%; Chicken: 85%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Form: Purified

• Applications: Western Blot
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: APC1calcium-binding mitochondrial carrier protein SCaMC-1, calcium-binding transporter, DKFZp586G0123, MCSC1, Mitochondrial ATP-Mg/Pi carrier protein 1, mitochondrial ATP-Mg/Pi transporter, Mitochondrial Ca(2+)-dependent solute carrier protein 1, SCAMC1, SCAMC-1, short calcium-binding mitochondrial carrier 1, Small calcium-binding mitochondrial carrier protein 1, solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 24, Solute carrier family 25 member 24
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 29957
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG