Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SLC25A45 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
Antigen | SLC25A45 |
---|---|
Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Form | Purified |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP15987620
![]() |
Novus Biologicals
NBP15987620UL |
20 μL |
Each for $206.00
|
|
|||||
NBP159876
![]() |
Novus Biologicals
NBP159876 |
100 μL |
Each for $487.50
|
|
|||||
Description
SLC25A45 Polyclonal specifically detects SLC25A45 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
SLC25A45 | |
Polyclonal | |
Purified | |
RUO | |
solute carrier family 25 member 45, solute carrier family 25, member 45 | |
SLC25A45 | |
IgG | |
Protein A purified |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
Rabbit | |
Q8N413-2 | |
283130 | |
Synthetic peptides corresponding to LOC283130 The peptide sequence was selected from the C terminal of LOC283130. Peptide sequence GLRRRVYQGMLDCMVSSIRQEGLGVFFRGVTINSARAFPVNAVTFLSYEY. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title