Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. SLC26A1 Antibody, Novus Biologicals™

SLC26A1 Antibody, Novus Biologicals™
SDP

Catalog No. p-200043825 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.1 mL
25ul
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB432447 25ul
NBP184897 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB432447 Supplier Novus Biologicals Supplier No. NBP18489725UL
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody has been used in 1 publication

SLC26A1 Polyclonal specifically detects SLC26A1 in Human, Rat samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen SLC26A1
Applications Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:1000 - 1:2500
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias EDM4, SAT1, SAT-1sulfate anion transporter 1, solute carrier family 26 (sulfate transporter), member 1, Solute carrier family 26 member 1, sulfate anion tranporter AT1, sulfate transporter, sulfate/anion transporter SAT-1 protein
Gene Symbols SLC26A1
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:DTAFYEDATEFEGLVPEPGVRVFRFGGPLYYANKDFFLRSLYSLTGLDAGCMAARRKEGGSETGVGEGGP
Purification Method Affinity Purified
Quantity 25ul
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 10861
Test Specificity Specificity of human SLC26A1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human, Rat
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.