Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NBP179393

SMYD3 Antibody, Novus Biologicals™
SDP

Catalog No. NBP179393 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP179393 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP179393 Supplier Novus Biologicals Supplier No. NBP179393
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

SMYD3 Polyclonal specifically detects SMYD3 in Human samples. It is validated for Western Blot, Chromatin Immunoprecipitation, Chromatin Immunoprecipitation (ChIP).

Specifications

Antigen SMYD3
Applications Western Blot, ChIP Assay
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Chromatin Immunoprecipitation (ChIP) 1:10-1:500
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. NP_073580
Gene Alias bA74P14.1, bA74P14.1 (novel protein), EC 2.1.1, EC 2.1.1.43, FLJ21080, KMT3E, MGC104324, MYND domain containing 1, SET and MYND domain containing 3, SET and MYND domain-containing protein 3, Zinc finger MYND domain-containing protein 1, zinc finger protein, subfamily 3A (MYND domain containing), 1, ZMYND1, ZNFN3A1
Gene Symbols SMYD3
Host Species Rabbit
Immunogen Synthetic peptide directed towards the N terminal of human SMYD3The immunogen for this antibody is SMYD3. Peptide sequence PRYPPDSVRLLGRVVFKLMDGAPSESEKLYSFYDLESNINKLTEDKKEGL.
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 64754
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.