SNAP47 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP156894

Catalog No. NBP156894

Description

SNAP47 Polyclonal specifically detects SNAP47 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: SNAP47
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q5SQN1
• Gene Symbols: SNAP47
• Immunogen: Synthetic peptides corresponding to C1ORF142 The peptide sequence was selected from the middle region of C1ORF142 (NP_444280). Peptide sequence TALHLQTSLPALSEADTQELTQILRRMKGLALEAESELERQDEALDGVAA.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 116841
• Target Species: Human, Mouse, Rat, Porcine, Bovine, Equine, Rabbit, Yeast, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: C1orf142, Epididymis luminal protein 170, FLJ12517, HEL170, SNAP-47chromosome 1 open reading frame 142, SVAP1DKFZp686M10160, Synaptosomal-associated 47 kDa protein, synaptosomal-associated protein 47, synaptosomal-associated protein, 47kDa
• Host Species: Rabbit
• Molecular Weight of Antigen: 52.5 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.