Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SNRPN Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | SNRPN |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
SNRPN Polyclonal specifically detects SNRPN in Human samples. It is validated for Western Blot.Specifications
| SNRPN | |
| Polyclonal | |
| Rabbit | |
| Diabetes Research | |
| DKFZp686C0927, DKFZp686M12165, DKFZp761I1912, DKFZp762N022, FLJ39265, HCERN3FLJ33569, MGC29886, Prader-Willi syndrome chromosome region, PWCR, RT-LI, Sm protein D, Sm protein N, small nuclear ribonucleoprotein polypeptide N, small nuclear ribonucleoprotein-associated protein N, Sm-D, sm-N, SmN, SMNFLJ36996, SNRNP-N, SNURF-SNRPN, tissue-specific splicing protein, Tissue-specific-splicing protein | |
| SNRPN | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| P63162 | |
| 6638 | |
| Synthetic peptides corresponding to the N terminal of SNRPN. Immunizing peptide sequence DEFRKIKPKNAKQPEREEKRVLGLVLLRGENLVSMTVEGPPPKDTGIARV. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title