Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Somatostatin R4/SSTR4 Antibody, Novus Biologicals™
SDP

Catalog No. p-200075349 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB436034 25 μL
NBP239022 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB436034 Supplier Novus Biologicals Supplier No. NBP23902225UL
Only null left
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody has been used in 1 publication

Somatostatin R4/SSTR4 Polyclonal specifically detects Somatostatin R4/SSTR4 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen Somatostatin R4/SSTR4
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. P31391
Gene Alias G-protein coupled receptor, somatostatin receptor 4, somatostatin receptor type 4, SS4R, SS-4-R, SS4-R
Gene Symbols SSTR4
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: YATALKSKGGAGCMCPPLPCQQEALQPEPGRKRIPLTRTTTF
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Breast Cancer, Cell Cycle and Replication
Primary or Secondary Primary
Gene ID (Entrez) 6754
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.