SPATA2L Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP156681

Catalog No. NBP156681

Description

SPATA2L Polyclonal specifically detects SPATA2L in Human samples. It is validated for Western Blot.

Specifications

• Antigen: SPATA2L
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: C16orf76, chromosome 16 open reading frame 76, MGC26885, SPATA2-like protein, spermatogenesis associated 2-like, spermatogenesis-associated protein 2-like protein, tamo
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 124044
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q8IUW3
• Gene Symbols: SPATA2L
• Immunogen: Synthetic peptides corresponding to SPATA2L(spermatogenesis associated 2-like) The peptide sequence was selected from the middle region of SPATA2L. Peptide sequence SPPAELAYRPPLWEQSAKLWGTGGRAWEPPAEELPQASSPPYGALEEGLE.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Canine: 85%; Rat: 78%.
• Target Species: Human, Rat, Canine, Guinea Pig
• Isotype: IgG