Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SPATA2L Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP156681
Description
SPATA2L Polyclonal specifically detects SPATA2L in Human samples. It is validated for Western Blot.Specifications
| SPATA2L | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| C16orf76, chromosome 16 open reading frame 76, MGC26885, SPATA2-like protein, spermatogenesis associated 2-like, spermatogenesis-associated protein 2-like protein, tamo | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 124044 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| Q8IUW3 | |
| SPATA2L | |
| Synthetic peptides corresponding to SPATA2L(spermatogenesis associated 2-like) The peptide sequence was selected from the middle region of SPATA2L. Peptide sequence SPPAELAYRPPLWEQSAKLWGTGGRAWEPPAEELPQASSPPYGALEEGLE. | |
| 100 μL | |
| Primary | |
| Expected identity based on immunogen sequence: Canine: 85%; Rat: 78%. | |
| Human, Rat, Canine, Guinea Pig | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction