Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SPPL3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$158.00 - $487.50
Specifications
| Antigen | SPPL3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15707020
|
Novus Biologicals
NBP15707020UL |
20 μL |
Each for $158.00
|
|
|||||
|
NBP157070
|
Novus Biologicals
NBP157070 |
100 μL |
Each for $487.50
|
|
|||||
Description
SPPL3 Polyclonal specifically detects SPPL3 in Human samples. It is validated for Western Blot.Specifications
| SPPL3 | |
| Polyclonal | |
| Rabbit | |
| Q3MJ04 | |
| 121665 | |
| Synthetic peptides corresponding to UNQ1887 (signal peptide peptidase 3) The peptide sequence was selected from the middle region of UNQ1887. Peptide sequence VMVKVATQPADNPLDVLSRKLHLGPNVGRDVPRLSLPGKLVFPSSTGSHF. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| DKFZp586C1324, EC 3.4.23.-, IMP-2, IMP2MGC126674, Intramembrane protease 2, MDHV1887, MGC126676, MGC90402, Presenilin-like protein 4, PRO4332, PSL4, signal peptide peptidase 3, signal peptide peptidase-like 3, SPP-like 3 | |
| SPPL3 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title