Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SPRY1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$377.03 - $728.30
Specifications
| Antigen | SPRY1 |
|---|---|
| Applications | Western Blot, Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
SPRY1 Polyclonal specifically detects SPRY1 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
| SPRY1 | |
| Polyclonal | |
| Rabbit | |
| Cancer, Growth and Development, Neuronal Cell Markers, Signal Transduction | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 10252 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PTRPVPGHRSERAIRTQPKQLIVDDLKGSLKEDLTQHKFICEQCGKCKC | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| Drosophila, homolog of, 1 (antagonist of FGF signaling), sprouty homolog 1, antagonist of FGF signaling (Drosophila), spry-1 | |
| SPRY1 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title