Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. STARD3 Antibody, Novus Biologicals™

STARD3 Antibody, Novus Biologicals™
SDP

Catalog No. NB239794 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μg
25 μg
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB239794 100 μg
NB239982 25 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB239794 Supplier Novus Biologicals Supplier No. NBP321243100UL
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

STARD3 Polyclonal antibody specifically detects STARD3 in Human samples. It is validated for Western Blot

Specifications

Antigen STARD3
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 ug/ml
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias CAB1, es64, Metastatic lymph node gene 64 protein, metastatic lymph node protein 64, MLN 64, MLN64FLJ41370, Protein CAB1, StARD3, StAR-related lipid transfer (START) domain containing 3, stAR-related lipid transfer protein 3, START domain containing 3, START domain-containing protein 3, steroidogenic acute regulatory protein related
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: LPQEAEEERWYLAAQVAVARGPLLFSGALSEGQFYSPPESFAGSDNESDEEVAGKKSFSAQEREYIRQGKEATAVVDQILAQEENWKFEKNNEYGDTVYTIEVPFHGKTFILKTFLPCPAELVYQEVILQPERMVLWNK
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Breast Cancer, Cancer, Lipid and Metabolism
Primary or Secondary Primary
Gene ID (Entrez) 10948
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.