Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Synaptotagmin 1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00
Specifications
| Classification | Polyclonal |
|---|---|
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Regulatory Status | RUO |
| Gene Accession No. | NP_033332 |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP19149920
|
Novus Biologicals
NBP19149920UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP191499
|
Novus Biologicals
NBP191499 |
100 μL | N/A | N/A | N/A | ||||
Description
Synaptotagmin 1 Polyclonal specifically detects Synaptotagmin 1 in Mouse, Bovine samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| Polyclonal | |
| Rabbit | |
| NP_033332 | |
| 6857 | |
| Synthetic peptide directed towards the middle region of human Syt1. Peptide sequence FDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSL. | |
| Primary |
| Unconjugated | |
| RUO | |
| DKFZp781D2042, p65, SVP65, synaptotagmin Isynaptotagmin 1, synaptotagmin-1, SYT, SytI | |
| SYT1 | |
| IgG | |
| 47 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title