Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TADA1L Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | TADA1L |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15662920
|
Novus Biologicals
NBP15662920UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP156629
|
Novus Biologicals
NBP156629 |
100 μL |
Each for $487.50
|
|
|||||
Description
TADA1L Polyclonal specifically detects TADA1L in Human samples. It is validated for Western Blot.Specifications
| TADA1L | |
| Polyclonal | |
| Rabbit | |
| Q96BN2 | |
| 117143 | |
| Synthetic peptides corresponding to TADA1L(transcriptional adaptor 1 (HFI1 homolog, yeast)-like) The peptide sequence was selected from the C terminal of TADA1L (NP_444281). Peptide sequence REVIPTHTVYALNIERIITKLWHPNHEELQQDKVHRQRLAAKEGLLLC. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| ADA1, hADA1, HFI1, SPT3-associated factor 42, SPT3-associated factor 42 (STAF42), STAF42transcriptional adaptor 1 (HFI1 homolog, yeast)-like, TADA1LRP1-9E21.4, transcriptional adapter 1, Transcriptional adapter 1-like protein, transcriptional adaptor 1, transcriptional adaptor 1 (HFI1 homolog, yeast) | |
| TADA1 | |
| IgG | |
| 37 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title