Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Tapasin Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$206.00 - $487.50

Specifications

Antigen	Tapasin
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit
Regulatory Status	RUO

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP15907020 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP15907020UL	20 μL	Each for $206.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP159070 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP159070	100 μL	Each for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

Tapasin Polyclonal specifically detects Tapasin in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen	Tapasin
Conjugate	Unconjugated
Regulatory Status	RUO
Gene ID (Entrez)	6892
Immunogen	Synthetic peptides corresponding to TAPBP (TAP binding protein (tapasin)) The peptide sequence was selected from the N terminal of TAPBP. Peptide sequence GKGLAKRPGALLLRQGPGEPPPRPDLDPELYLSVHDPAGALQAAFRRYPR.
Primary or Secondary	Primary

Classification	Polyclonal
Host Species	Rabbit
Gene Alias	NGS17, NGS-17, TAP binding protein (tapasin), tapasin, TAPATAP-associated protein, TPN, TPSNTAP-binding protein
Gene Symbols	TAPBP
Isotype	IgG

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

Tapasin Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents