Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Testisin/Prss21 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | Testisin/Prss21 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP179539
![]() |
Novus Biologicals
NBP179539 |
100 μL |
Each for $487.50
|
|
|||||
NBP17953920
![]() |
Novus Biologicals
NBP17953920UL |
20 μL | N/A | N/A | N/A | ||||
Description
Testisin/Prss21 Polyclonal specifically detects Testisin/Prss21 in Human samples. It is validated for Western Blot.Specifications
Testisin/Prss21 | |
Polyclonal | |
Rabbit | |
NP_659206 | |
10942 | |
Synthetic peptide directed towards the N terminal of human PRSS21. Peptide sequence RRVITSRIVGGEDAELGRWPWQGSLRLWDSHVCGVSLLSHRWALTAAHCF. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
EC 3.4.21, Eosinophil serine protease 1, ESP1EC 3.4.21.-, ESP-1serine protease from eosinophils, protease, serine, 21 (testisin), Serine protease 21, TEST1testisin, TESTISIN | |
PRSS21 | |
IgG | |
33 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title