Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Testisin/Prss21 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $436.00

Specifications

Antigen Testisin/Prss21
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP17953920
View Documents
Novus Biologicals
NBP17953920UL
20 μL
Each for $152.22
Add to cart
 
NBP179539
View Documents
Novus Biologicals
NBP179539
100 μL
Each for $436.00
Add to cart
 
Description

Description

Testisin/Prss21 Polyclonal specifically detects Testisin/Prss21 in Human samples. It is validated for Western Blot.
Specifications

Specifications

Testisin/Prss21
Polyclonal
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
EC 3.4.21, Eosinophil serine protease 1, ESP1EC 3.4.21.-, ESP-1serine protease from eosinophils, protease, serine, 21 (testisin), Serine protease 21, TEST1testisin, TESTISIN
PRSS21
IgG
Affinity Purified
33 kDa
Western Blot
Unconjugated
RUO
NP_659206
10942
Synthetic peptide directed towards the N terminal of human PRSS21. Peptide sequence RRVITSRIVGGEDAELGRWPWQGSLRLWDSHVCGVSLLSHRWALTAAHCF.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit