Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TFIIE beta Rabbit anti-Human, Polyclonal, Novus Biologicals™
SDP

Catalog No. p-7234385 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB126709 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB126709 Supplier Novus Biologicals Supplier No. NBP310905100UL
Only null left
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

TFIIE beta Polyclonal specifically detects TFIIE beta in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen TFIIE beta
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin
Formulation PBS buffer, 2% sucrose
Gene Alias FE, General transcription factor IIE subunit 2, general transcription factor IIE, polypeptide 2 (beta subunit, 34kD), general transcription factor IIE, polypeptide 2, beta 34kDa, TF2E2TFIIE-beta, TFIIE-B, transcription initiation factor IIE subunit beta
Host Species Rabbit
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human TFIIE beta (NP_002086). Peptide sequence VEHGGSSGSKQNSDHSNGSFNLKALSGSSGYKFGVLAKIVNYMKTRHQRG
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 2961
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.