Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TGDS Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | TGDS |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
TGDS Polyclonal specifically detects TGDS in Human samples. It is validated for Western Blot.Specifications
| TGDS | |
| Polyclonal | |
| Rabbit | |
| O95455 | |
| 23483 | |
| Synthetic peptides corresponding to TGDS (TDP-glucose 4,6-dehydratase) The peptide sequence was selected from the middle region of TGDS)(50ug). Peptide sequence DEVYGGSLDKEFDESSPKQPTNPYASSKAAAECFVQSYWEQYKFPVVITR. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| dTDP-D-glucose 4,6-dehydratase, EC 4.2.1.46, growth-inhibiting protein 21, P, SDR2E1, short chain dehydrogenase/reductase family 2E, member 1, TDPGD, TDP-glucose 4,6-dehydratase | |
| TGDS | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title