Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
                
Learn More
Learn More
                                THEG Antibody, Novus Biologicals™
                                
                                
                                
                                
                            
                            
                            
                                
                                    
Rabbit Polyclonal Antibody
$499.50
Specifications
| Antigen | THEG | 
|---|---|
| Applications | Western Blot | 
| Classification | Polyclonal | 
| Conjugate | Unconjugated | 
| Host Species | Rabbit | 
Description
THEG Polyclonal specifically detects THEG in Human samples. It is validated for Western Blot.Specifications
| THEG | |
| Polyclonal | |
| Rabbit | |
| NP_954672 | |
| 51298 | |
| Synthetic peptide directed towards the middle region of human THEG. Peptide sequence: DRPSVYWTERFLEDTTLTITVPAVSRRVEELSRPKRFYLEYYNNNRTTPV | |
| Primary | 
| Western Blot | |
| Unconjugated | |
| RUO | |
| CT56Cancer/testis antigen 56, MGC26138, testis-specific, Theg homolog, Theg homolog (mouse) | |
| THEG | |
| IgG | |
| 41 kDa | 
Spot an opportunity for improvement?Share a Content Correction
            
                    Product Content Correction
                
                Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title