Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Custom Products and Services
  4. Custom Enzymes and Inhibitors
  5. Novus Biologicals™ TIRAP (TLR2 and TLR4) Inhibitor Peptide Set

Novus Biologicals™ TIRAP (TLR2 and TLR4) Inhibitor Peptide Set
SDP

Catalog No. NBP226245 Shop All R&D Systems Products
Click to view available options
Quantity:
1 mg

Description

Applications: Flow Cytometry, In vitro assay

TLR2 / TLR4 Inhibitor Peptide: 1mg (lyophilized); sequence: DRQIKIWFQNRRMKWKKPGFLRDPWCKYQML (Inhibitor sequence: PGFLRDPWCKYQML); Molecular weight: 4097.92 Da ; Antennapedia Control Peptide: 1mg (lyophilized); sequence: DRQIKIWFQNRRMKWKK; Molecular weight: 2361 Da

Specifications

Color White
Components TLR2 / TLR4 Inhibitor Peptide: 1mg (lyophilized); sequence: DRQIKIWFQNRRMKWKKPGFLRDPWCKYQML (Inhibitor sequence: PGFLRDPWCKYQML); Molecular weight: 4097.92 Da ; Antennapedia Control Peptide: 1mg (lyophilized); sequence: DRQIKIWFQNRRMKWKK; Molecular weight: 2361 Da
For Use With (Application) Inhibit TLR2 and TLR4 signaling
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Quantity 1 mg
Product Type TIRAP (TLR2 and TLR4) Inhibitor Peptide Set
Inhibitors TLR2 and TLR4
Form Solid

For Research Use Only

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.