Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. TLE1 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

TLE1 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
SDP

Catalog No. NB125461 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB125461 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB125461 Supplier Novus Biologicals Supplier No. NBP310280100UL
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

TLE1 Polyclonal specifically detects TLE1 in Mouse samples. It is validated for Western Blot.

Specifications

Antigen TLE1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS buffer, 2% sucrose
Gene Alias E(Sp1) homolog, enhancer of split groucho 1, ESG, ESG1Enhancer of split groucho-like protein 1, GRG1, transducin-like enhancer of split 1 (E(sp1) homolog, Drosophila), transducin-like enhancer of split 1, homolog of Drosophila E(sp1), transducin-like enhancer protein 1
Host Species Rabbit
Immunogen The immunogen is a synthetic peptide directed towards the middle region of mouse TLE1 (NP_001272459.1). Peptide sequence VPDSLRSTDKRRNGPEFSSDIKKRKVDDKDNYDSDGDKSDDNLVVDVSNE
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 7088
Target Species Mouse
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.