Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TMLHE Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$487.50

Specifications

Antigen	TMLHE
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 1

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP154725 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP154725	100 μL	Each of 1 for $487.50	Only null left	Sign In or Register to check your price. Add to Cart

Description

TMLHE Polyclonal specifically detects TMLHE in Human samples. It is validated for Western Blot.

Specifications

Antigen	TMLHE
Classification	Polyclonal
Host Species	Rabbit
Research Discipline	DNA Repair, Mismatch Repair
Gene Alias	BBOX2TML-alpha-ketoglutarate dioxygenase, butyrobetaine (gamma), 2-oxoglutarate dioxygenase (gamma-butyrobetainehydroxylase) 2, EC 1.14.11.8, Epsilon-trimethyllysine 2-oxoglutarate dioxygenase, Epsilon-trimethyllysine hydroxylase, FLJ10727, TML dioxygenase, TMLD, TMLHTML hydroxylase, trimethyllysine dioxygenase, mitochondrial, trimethyllysine hydroxylase, epsilon, XAP130
Gene Symbols	TMLHE
Isotype	IgG
Molecular Weight of Antigen	49 kDa

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Accession No.	Q9NVH6
Gene ID (Entrez)	55217
Immunogen	Synthetic peptides corresponding to TMLHE(trimethyllysine hydroxylase, epsilon) The peptide sequence was selected from the middle region of TMLHE. Peptide sequence PWNKELYLIRYNNYDRAVINTVPYDVVHRWYTAHRTLTIELRRPENEFWV.
Primary or Secondary	Primary

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

TMLHE Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents