Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Tollip Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP18159625UL
Description
Tollip Polyclonal specifically detects Tollip in Human, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin, Knockdown Validated.Specifications
Tollip | |
Polyclonal | |
Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200, Knockdown Validated | |
Q9H0E2 | |
TOLLIP | |
This antibody was developed against Recombinant Protein corresponding to amino acids:VVQAKLAKNYGMTRMDPYCRLRLGYAVYETPTAHNGAKNPRWNKVIHCTVPPGVDSFYLEIFDERAFSMDDRIAWTHITIPES | |
Affinity Purified | |
RUO | |
54472 | |
Human, Rat | |
IgG |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), KnockDown | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
adapter protein, FLJ33531, IL-1RAcPIP, toll interacting protein, toll-interacting protein | |
Rabbit | |
30 kDa | |
25 μL | |
Primary | |
Specificity of human Tollip antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction