Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. TPD52L3/D55 Antibody, Novus Biologicals™

TPD52L3/D55 Antibody, Novus Biologicals™
SDP

Catalog No. NBP15649820 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15649820 20 μL
NBP156498 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15649820 Supplier Novus Biologicals Supplier No. NBP15649820UL

Description

Rabbit Polyclonal Antibody

TPD52L3/D55 Polyclonal specifically detects TPD52L3/D55 in Human samples. It is validated for Western Blot.

Specifications

Antigen TPD52L3/D55
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q96J77-2
Gene Alias hD55, MGC26757, NYDSP25, NYD-SP25, protein kinase NYD-SP25, Testis development protein NYD-SP25, tumor protein D52-like 3MGC45374, tumor protein D55
Gene Symbols TPD52L3
Host Species Rabbit
Immunogen Synthetic peptides corresponding to TPD52L3(tumor protein D52-like 3) The peptide sequence was selected from the middle region of TPD52L3. Peptide sequence GLRQNLSKSWLDVQVSNTYVKQKTSAALSTMGTLICRKLGGVKKSATLRS.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Research Discipline Protein Kinase
Primary or Secondary Primary
Gene ID (Entrez) 89882
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.