Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TPD52L3/D55 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15649820UL
Description
TPD52L3/D55 Polyclonal specifically detects TPD52L3/D55 in Human samples. It is validated for Western Blot.Specifications
TPD52L3/D55 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q96J77-2 | |
TPD52L3 | |
Synthetic peptides corresponding to TPD52L3(tumor protein D52-like 3) The peptide sequence was selected from the middle region of TPD52L3. Peptide sequence GLRQNLSKSWLDVQVSNTYVKQKTSAALSTMGTLICRKLGGVKKSATLRS. | |
20 μL | |
Protein Kinase | |
89882 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
hD55, MGC26757, NYDSP25, NYD-SP25, protein kinase NYD-SP25, Testis development protein NYD-SP25, tumor protein D52-like 3MGC45374, tumor protein D55 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction