TSGA2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 2 publications

Catalog Number	Mfr. No.	Quantity
NB405756	Novus Biologicals NBP18984025UL	25 μL
NBP189840	Novus Biologicals NBP189840	0.1 mL

Description

TSGA2 Polyclonal specifically detects TSGA2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: TSGA2
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Cell Cycle and Replication
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 89765
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:KPTSTDGPGQDAPGAESAGEPGEEAQALLEGFEGEMDMRPGDEDADVLREESREYDQEEFRYDMDEGNINSEEEETRQSDLQD
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Alias: Cancer/testis antigen 79, CT79, FLJ32753, h-meichroacidin, Male meiotic metaphase chromosome-associated acidic protein, Meichroacidin, radial spoke head 1 homolog, radial spoke head 1 homolog (Chlamydomonas), RSP44, RSPH10A, testes specific A2 homolog, testes specific gene A2 homolog, testis specific A2 homolog, testis specific A2 homolog (mouse), Testis-specific gene A2 protein, TSA2MGC126568, TSGA2MGC141927
• Gene Symbols: RSPH1
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only