Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
U1A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | U1A |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
U1A Polyclonal specifically detects U1A in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| U1A | |
| Polyclonal | |
| Rabbit | |
| NP_004587 | |
| 6626 | |
| Synthetic peptide directed towards the middle region of human SNRPA. Peptide sequence MPGQMPPAQPLSENPPNHILFLTNLPEETNELMLSMLFNQFPGFKEVRLV. | |
| Primary |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Mud1, small nuclear ribonucleoprotein polypeptide A, U1 snRNP A, U1 snRNP-specific protein A, U1-AU1 small nuclear ribonucleoprotein A, U1AU1 small nuclear RNP-specific A | |
| SNRPA | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title