Ubiquilin 1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP156536

Catalog No. NBP156536

Description

Ubiquilin 1 Polyclonal specifically detects Ubiquilin 1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Ubiquilin 1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: DA41FLJ90054, DSK2, hPLIC-1, PLIC1, PLIC-1UBQN, Protein linking IAP with cytoskeleton 1, ubiquilin 1, ubiquilin-1, XDRP1
• Host Species: Rabbit
• Molecular Weight of Antigen: 62 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Equine: 100%; Human: 100%; Rabbit: 100%; Sheep: 100%; Chicken: 85%; Mouse: 85%; Rat: 85%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Sheep, Zebrafish
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
• Gene Accession No.: Q5T6J9
• Gene Symbols: UBQLN1
• Immunogen: Synthetic peptides corresponding to UBQLN1(ubiquilin 1) The peptide sequence was selected from the middle region of UBQLN1. Peptide sequence QFGGNPFASLVSNTSSGEGSQPSRTENRDPLPNPWAPQTSQSSSASSGTA.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 29979
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.