Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Ubiquilin 1 Antibody, Novus Biologicals™

Ubiquilin 1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP15653620 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15653620 20 μL
NBP156536 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15653620 Supplier Novus Biologicals Supplier No. NBP15653620UL

Description

Rabbit Polyclonal Antibody

Ubiquilin 1 Polyclonal specifically detects Ubiquilin 1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen Ubiquilin 1
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q5T6J9
Gene Alias DA41FLJ90054, DSK2, hPLIC-1, PLIC1, PLIC-1UBQN, Protein linking IAP with cytoskeleton 1, ubiquilin 1, ubiquilin-1, XDRP1
Gene Symbols UBQLN1
Host Species Rabbit
Immunogen Synthetic peptides corresponding to UBQLN1(ubiquilin 1) The peptide sequence was selected from the middle region of UBQLN1. Peptide sequence QFGGNPFASLVSNTSSGEGSQPSRTENRDPLPNPWAPQTSQSSSASSGTA.
Molecular Weight of Antigen 62 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 29979
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.