Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Ubiquilin 1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
Antigen | Ubiquilin 1 |
---|---|
Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP15653620
![]() |
Novus Biologicals
NBP15653620UL |
20 μL |
Each for $206.00
|
|
|||||
NBP156536
![]() |
Novus Biologicals
NBP156536 |
100 μL |
Each for $487.50
|
|
|||||
Description
Ubiquilin 1 Polyclonal specifically detects Ubiquilin 1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
Ubiquilin 1 | |
Polyclonal | |
Rabbit | |
Q5T6J9 | |
29979 | |
Synthetic peptides corresponding to UBQLN1(ubiquilin 1) The peptide sequence was selected from the middle region of UBQLN1. Peptide sequence QFGGNPFASLVSNTSSGEGSQPSRTENRDPLPNPWAPQTSQSSSASSGTA. | |
Primary |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
DA41FLJ90054, DSK2, hPLIC-1, PLIC1, PLIC-1UBQN, Protein linking IAP with cytoskeleton 1, ubiquilin 1, ubiquilin-1, XDRP1 | |
UBQLN1 | |
IgG | |
62 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title