Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Ubiquilin 1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $436.00

Specifications

Antigen Ubiquilin 1
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP15653620
View Documents
Novus Biologicals
NBP15653620UL
20 μL
Each for $152.22
Add to cart
 
NBP156536
View Documents
Novus Biologicals
NBP156536
100 μL
Each for $436.00
Add to cart
 
Description

Description

Ubiquilin 1 Polyclonal specifically detects Ubiquilin 1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications

Specifications

Ubiquilin 1
Polyclonal
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
DA41FLJ90054, DSK2, hPLIC-1, PLIC1, PLIC-1UBQN, Protein linking IAP with cytoskeleton 1, ubiquilin 1, ubiquilin-1, XDRP1
UBQLN1
IgG
Affinity Purified
62 kDa
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Unconjugated
RUO
Q5T6J9
29979
Synthetic peptides corresponding to UBQLN1(ubiquilin 1) The peptide sequence was selected from the middle region of UBQLN1. Peptide sequence QFGGNPFASLVSNTSSGEGSQPSRTENRDPLPNPWAPQTSQSSSASSGTA.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit