UBTD2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB406684	Novus Biologicals NBP18527625UL	25ul
NBP185276	Novus Biologicals NBP185276	0.1 mL

Description

UBTD2 Polyclonal specifically detects UBTD2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: UBTD2
• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 92181
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:TVFHMKRRLHAAEGVEPGSQRWFFSGRPLTDKMKFEELKIPKDYVVQVIVSQPVQNPTPV
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:10 - 1:20
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human
• Gene Alias: DC-UbP, DCUBPDendritic cell-derived ubiquitin-like protein, MGC30022ubiquitin domain-containing protein 2, ubiquitin domain containing 2, Ubiquitin-like protein SB72
• Gene Symbols: UBTD2
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only