UMPS Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP18589525UL

Catalog No. NB432212

Description

UMPS Polyclonal specifically detects UMPS in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: UMPS
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Alias: EC 4.1.1.23, OMPdecase, OPRT, OPRTase, orotate phosphoribosyltransferase, orotidine 5'-phosphate decarboxylase, UMP synthase, uridine 5'-monophosphate synthase, uridine monophosphate synthetase
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: UMPS
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:RLLSQVADILFQTAQNAGISFDTVCGVPYTALPLATVICSTNQIPMLIRRKETKDYGTKRLVEGTINPGETCLIIEDVVTSGSSVL
• Quantity: 25 μL
• Research Discipline: DNA replication Transcription Translation and Splicing, metabolism
• Gene ID (Entrez): 7372
• Target Species: Human, Mouse, Rat
• Isotype: IgG

For Research Use Only